PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013613751.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 303aa    MW: 33302.6 Da    PI: 8.6768
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013613751.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.57.2e-09757348
                     SS-HHHHHHHHHHHHHTTTT......-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg......tWktIartmgkgRtlkqcksrwqkyl 48
                      W+ eE++ + +a++++  +      +W + a++++ +++l ++k+++q++l
   XP_013613751.1  7 TWSIEEEKSFENAIAMHCVEeeitedQWMKMASMVP-TKSLQEVKNHYQMLL 57
                     6****************999****************.************986 PP

2Myb_DNA-binding41.53.2e-13132176347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + +++G+g+W++I+r    +Rt+ q+ s+ qky
   XP_013613751.1 132 PWTQEEHRLFLLGLEKFGKGDWRSISRNYVITRTPTQVASHAQKY 176
                      7*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.601361IPR017884SANT domain
SMARTSM007170.0042459IPR001005SANT/Myb domain
SuperFamilySSF466895.02E-8762IPR009057Homeodomain-like
PfamPF002494.4E-7757IPR001005SANT/Myb domain
CDDcd001671.07E-5757No hitNo description
PROSITE profilePS5129417.259125181IPR017930Myb domain
SuperFamilySSF466892.8E-17126182IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-17128179IPR006447Myb domain, plants
SMARTSM007176.6E-11129179IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-10130175IPR009057Homeodomain-like
CDDcd001672.10E-10132177No hitNo description
PfamPF002491.0E-11132176IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MESVAVTWSI EEEKSFENAI AMHCVEEEIT EDQWMKMASM VPTKSLQEVK NHYQMLLEDV  60
KAIESGQVPL PRYQRTGEEA AATSPANRDC HSSGGGGSTE KKPNHGVSGI SSSNGGGRSN  120
SKLEQERKKG IPWTQEEHRL FLLGLEKFGK GDWRSISRNY VITRTPTQVA SHAQKYFIRL  180
NSMNRDRRRS SIHDITSVNN QAPAVTGQQQ QQQVVKHRLA QPQPPPQPQP QHHTMAGLGI  240
YGGAPVGQPI IAPPDHMGSA VGTPVMLPPP MGTHHHLGVA PYAVPSYPVP PLPQQHPAPS  300
TMH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A8e-148771177RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013715778.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_013613751.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H75e-58DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A078JF910.0A0A078JF91_BRANA; BnaCnng46710D protein
TrEMBLA0A0D2ZQJ20.0A0A0D2ZQJ2_BRAOL; Uncharacterized protein
STRINGBra014169.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM103042535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.11e-127MYB family protein